TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M1V8F4|M1V8F4_CYAME Uncharacterized protein OS=Cyanidioschyzon merolae strain 10D GN=CYME_CMK236C PE=4 SV=1
MEDDYGSIESAKPQQDASSAQAAIEASGSTRALILAAACLLTFGSYFCYDTPSALVITLREKLQLTGFQYNVLFSIYSWP
NVVLVFIGGLVIDTYGSRRASLALATLVLVGQVVMLIGVLQHRYWLLLSGRFIFGMGGESLGVCQSIIVSRWFAGHELAT
AFGLSLTVSRIGSILSFMLLPVVDQVAGIVSAFAVGVIICALSICAALVYASIELSVEHKRAEGAAALQPTKTRTRAPAG
ERSPRSRRSSLLQVARCLDLSFWLCAGISMVSYALVFSFIAIGSDLLHQAFGTSRERGSLLVSLVYDFSMVLAPLLGRLF
DAVGLRGIFVLVSCTLNLLSFALLEHTRTSAWQPVPRPVYGMICMGVAFSGLSSSVWPSMTVISPVWALGAALGIAQALQ
NLGTSLMSIYVGHVVDAFGYEAVLSRFVLIACIAVLLALWWNIDDWRYRDGRVNRSAAAAEAAAAAAMELPVAAGTPQGA
AVAYVPLYVPVYVMVSPEAIQSVRRACYQKLGESEVGIRRRDLYAQLGIAHPAVVRKAAETGAQLPSPDAYHARVFRPER
PTEAAGSASSSQSTN