TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M1V9R7|M1V9R7_CYAME Uncharacterized protein OS=Cyanidioschyzon merolae strain 10D GN=CYME_CMP041C PE=4 SV=1
MQPWLSTSLFYIAEAPAVLFLTLYLLVRYPTRLPGLGTPWYVYTTVGLAWFLSFLALILLPADLAETLFRRCEYLNKRSG
EDLSLHLRNCAPPSLSPAALLATWQALYWTSLVLGWILLPLVQSNISLEHLPLRERVRKALRPQLIALAVLAVVLSALAA
AVRSPRHHGLQLETWRATIIGLNNAFGLFLLMIFLGFGLVELPRTLWERSDPRRRLRAYAIRIAELHARHLETLQSLSRL
RLQAAVLGIGCTDDQTLQSQEQSHMPGHARSATHAYRQELCSRIETLLNLVPLHSSDLEIGQQPQKTWSSATPRATRMAE
SASLGTLFVEVRRAVLEYRRIEYLWQRISQRALFLQDLLQWRSAGCSSSAAASSACAGVLSTGSVSTSDVDRMPSTLVYA
CRAGESPGATASRMGSFHDAGEDLSPERSMRIVHDRALSNGDATSMPHLTKHATGAGAGSPQRIYISECERSVNAAVGTK
RWIDGMQRSLALRWRAYGEPFCLRVQAVVLFIVASAVCLSELTIWTVLLTPPRSFSPFARALHSLPLSPLGVQAMALSLV
CTLTSLVYFAVFHLQIYRWYELVPGYVDGQMLCLNAMLMSRFLLPLCYHLIFLLHENREAVARLLLYQYPQLMRHSGQDS
STVPVTAFETLMGSMHIVPLFGKAFNYFYPCSLVISALGTYFRLWGRLLDRFGLSRSLEFAEETISAAANNEVIGRQLLQ
RERARRQEASPCGLEPETRER