TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M2YRU5|M2YRU5_9NOCA Uncharacterized protein OS=Rhodococcus ruber BKS 20-38 OX=1278076 GN=G352_25877 PE=4 SV=1
MGLGAFLIVAAILIPTYTVGKLAKTPLDLEVTTVAEGTGDILNARALLSGRAQVDTDVPIVAQRFVTVEDPADADIMTLQ
AGQTVRRLDMQGDTGLVSATVDRVTVDRVSGMPVTKEENPDAVSTIQTSATAPPTEIPDRDGLQYRFPFGTEQKSYPYFD
LNARETYPIDYVDETEINGVKVYHFRHEIEPVDLSAVDPSVPTYKLSLPASTWGVEGGETPVTMTRWYTNVRDLWVEPET
GVVIKGQEQQYQYYAREADRPEVTVLQVSLPFNEDTIEFQVEQAKNGIDTLNLFGRTVPIILGILGLLALIAGIVLGLRG
GSGRTGRPVAATGGPTAPAGPAHAAPGQRDWTSDRTEEIPRTDAPPQQRDWTTDQTQEIPRTDLRKEPPQQ