TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M4VA25|M4VA25_9PROT Uncharacterized protein OS=Bdellovibrio exovorus JSS OX=1184267 GN=A11Q_1837 PE=4 SV=1
MGFIFIILGTLMWSFDTLIRYPLLASLRPDTMVFLEHALLTIIFVPLLFKTKSFFRQMNVRHLTSFLVIGVMGSAVSTLA
FTQAFALINPSLVILLQKLQPIVVILLSVFILKEKFSRRFFALSALALIGVFLISYPDISPLWMTTNSPIFQTGSHALLG
YGLTLLAVIGWGASTVFGKKLSTEGFNENEIMAGRFSLGFLFLLVFCLSQSSLPTTEISYDVYLKVAAMVLLSGLLGMSL
YYRGLSRLPAHISAIAEMFFPLSAVMINWIFLGKALLPIQIAGAIVLTASSIGIQLSRRHTN