TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M8ABW0|M8ABW0_RHIRD Uncharacterized protein OS=Agrobacterium tumefaciens str. Cherry 2E-2-2 GN=H009_23343 PE=4 SV=1
MFRSLFSLSKRPFSSLGEQEILALAISSEEDDSRIYRSYADHLRAQYPQSAKVFEDMAEVEQQHRNVLIDMHRRRFGETI
PLIRREHVRGFYERTPDWLVKNLSLEKIRAQAELMEAQAIRFYDEAVKRTSDASTRKLLGDLAEAERGHEDIAQMLEEKH
LDENGKTEEAETARRQFLLTYVQPGLAGLMDGSVSTLAPIFAAAFATQDTWQTFLIGLSASVGAGISMGFTEAAHDDGKL
SGRGSPVKRGLASGIMTAIGGLGHALPYLIPHFWTATAIAAVVVFVELWAIAFIQNRFMETPFLRAVFQVVLGGSLVLAA
GIIIGNG