TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M8KG08|M8KG08_ECOLX Lysis S family protein OS=Escherichia coli MP021552.12 GN=ECMP02155212_4700 PE=4 SV=1
MKSMDKISTGIAYGTSAGSAGYWFLQLLDKVTPSQWAAIGVLGIRTGGRVLAVNSQTRTLTLDREITLPSSGTTLISLVD
GQGSPVSVEVQSVTDGVKVKVSRVPDGVAEYSVWGLKLPTLRQRLFRCVSIRENDDGTYAITAVQHVPEKEAIVDNGAHF
DGDQSGTVNGVTPPAVQHLTAEVTADSGEYQVLARWDTPKVVKGVSFLLRLTVAADDGRERLVSTARTTETTYRFTQLAL
GNYRLTVRAVNARGQQGDPASVSFRIAAPAAPSRIELTPGYFQITATPHLAVYDPTVQFEFWFSEKRIADIRQVETSARY
LGTALYWIAASINIKPGHDYYFYVRSVNTVGKSAFVEAVGQPSDDASGYLDFFKGEIGKTHLAQELWTQIDNGQLAPDLT
EIRTSITDVSNEITQTVNKKLEDQSAAIQQIQKVQVDTNNNLNSMWAVKLQQMQDGRLYIAGIGAGIENPPDGMQSQVLL
AADRIAMINPANGNTKPMFVGQGDQIFMNEVFLKRLTAPTITSGGNPPAFSLTSDGRLTAKNADISGSVNANSGTLNNVT
INQNCTIKGMLEATQVRGDFVKAVSKAFPKKVGTWGNTETPNGTVTVTISDDHNFDRQIIIPPIIFNGIAYDDPGSGNNP
GGTRYTGYGFEVRKNGVLIASRETKGAIPGSYSAVIDMPSGRGSVTLEFKIFQKGNQGAGNITDCTVIVTKKAASGISIR