TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M9YRP5|M9YRP5_9INFA Matrix protein 2 (Fragment) OS=Influenza A virus (A/herring gull/Newfoundland/GR657/2011(H13N6)) GN=M2 PE=3 SV=1
MSLLTEVETPIRNEWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRIKYELKRGPSKEGVPESMREEYRQEQ
QNAV