TCDB is operated by the Saier Lab Bioinformatics Group
>MBJ06527.1 hypothetical protein CMO40_05315 [Verrucomicrobiaceae bacterium]
MLLSFFLLWSPFLRSQGISDNTEEAAVANLDETIIRAEQSIPALDLSKPGANRFNEDGIRHLSGAVSDPNELLEIFSNTQ
FNERRARLNAESLSDLSPTQVSISGGRPYENSFIIDGIPTNNLLDSLSRRGFDSVAASNQAVFIDSDLLESLQVFDSSVP
AEYGDFLGGAVISETRDPRDRLSVTFSGRYSSSALTEYLLDEAVRNEILSSPDPADRLLPGVTKFQRHQARFSVDLPVSD
LTGAIFSYGRQTAAVTRGALSSSYFLDTRPRDTIRENYFFKLKHNPDSKNSFTFQSLLTPYEDQYWRSSLSRQQGGGTST
KFRWDRSSGQSDFTADLAYTTANNSRTEEPVHFIYDNTPGISWIPSDIFSNPDARQSGLAGGFGYLENSQQQVDLALRHH
LDFDNSGLTYGLQARHINGFRARPHTNFSYRDAQPTFGLPIAAADLTDGTIIQNEQFLQERNDYLAYEAEAVINQFNIHA
TYAHELSLTDWLTLEPSLGLRYSYDDFLGNHNFAPRLNLKLGLPLDIGLTVGANRYYAKNQLVYALREQNPDNMVYKRDF
TFDGTQFTVGDWQLHAINRENSFGSSNLDTPYSEELSASLTLPVWSLGILRIKGISRDNRDSFARSEPIPDMFTDETGVA
VPFDRFELTNRGFSKYRSLSLDWSSSWRNHTFTAATTFSENIIAPGTDTLLSNTDVERLNKVVRYNGRDILYRDLEIERE
NFNTPFYXSFSWISRWLEDRLTVGLRGRFRAAYETIQSTDEFEEGLEVYEDRSFDSQFLIDGSLSYVHEFPALGPVEFEV
LVDNIFNTLPNVGVTRANPYQQGRAFTLGARFTF