TCDB is operated by the Saier Lab Bioinformatics Group
>tr|N1PXL2|N1PXL2_MYCP1 Uncharacterized protein OS=Mycosphaerella pini (strain NZE10 / CBS 128990) GN=DOTSEDRAFT_41505 PE=4 SV=1
MLDNMLTVLQITLPATITATAASSMFTGYTGVFEVCSSVVAAATSLANPFIMRRFTYRTQIYVCTAMTMLLYPVCTLPKP
LGKGMAESEAGPAIGAMLGGFVHAFGYSAFSALAVFFPAEANLALSAGSGLAVIVGPALLIGFLAIFGQEWHRSLLVFIS
TGPLIFLVWRFLMDQSCIRTAEESRIASRKAATTDSNDIESAAYAKSLDGEDATARQSDTPPSRWRLFCRTILPKNLLAF
ILLSVAANVATMGCTPVLQNLSRFKAAPKGNLQFEIICESHFTTHLLNCQLTCTVLISGVGNFVFSTVAAIWPKRNVWCW
TALQMFLCVIGVIQLFVPFLTYYTVWVLVMFVIGGCCGVARTNCTYGLQEDFKNRDDATRAFAQSHLGTGNFVGDAVGGG
FAVMVERLAIRYLKPTIR