TCDB is operated by the Saier Lab Bioinformatics Group
>NHJ04067.1 hypothetical protein EAX90_04540 [Candidatus Heimdallarchaeota archaeon]
MDSIELVIGIITIIPMAIGYIIAGLLIGRYFLRKNSIELLIAFMFISLASIWIGVCIIFFIAVFNLPTPSDITYIFSYAW
AIPILATIWNFITAALFEKQKYLKYIILGLFIVIDIIFLLMIYWKQDFIIEPNSIIYRDTTFGTYTSIILYFYLASALLF
IMPTYFWKGITSKHKLTKIKNILIACGSLLFSIVTILDGIITIDNLPTVIITRIILILTLIILSIGYFTPLKLEVNLESP
TNIEKKI