TCDB is operated by the Saier Lab Bioinformatics Group
>NP_001024134.1 Serpentine Receptor, class AB (class A-like) [Caenorhabditis elegans]
MNSNCTTMLTLSSSTALKTSMAFNLTIALIGFPLFGWSSLKLWTGAYTQNFHKNLRIIAQMHLTGFLLHCSGRIMLHSLD
LYNYTFLNPCAMIPNIYRCFTLRLMYNFGMWVTMCTAVPLVLERTLATHLKGRYENKRIWYGILFASLHVFLAAAPLMIA
YSNTKFDGVFMPYCNIYMPGHPEIANANSIIAITVQILARISFGCLFHVNKNLRSSMQRSSLSTRFQLEQNKNSMQCLKI
YANTSTIFLLIQIPSFGWILNEKFRPEYYLALQELNCAFPSYGIITVFLVSRKIFSVHNQIHSSLESQMKLQGEITYFEH
FNQQISTSKSS