TCDB is operated by the Saier Lab Bioinformatics Group
>NP_001122097.1 uncharacterized protein LOC245423 [Mus musculus]
MVVPEAGFKMGLSGRRVETKLCPGLHGLKWWLLLCFLATTCDAFFFPGLVPVTYCEEGHPNSYCKSSIQVYADKLYSVDS
VMFYDYDSFDFCQDSLKRTPSETLGQILFGEQVTSCPYKFSFNKDETCRKVCVKSYAPDNEDDMNKLAFLKKGIKQDYRH
HWIVDNTGIIWCYDTENEEHHCMSGFPIGCFNAPSDQVKGSCLINPEFNKNNSLYLFNHLDITITYHIESDTTVKVAKLI
SSRVDPKSYKHLDEDHLTCNEPPMEIPEEDTENLNVIYTYSVKFEESKATEWSSEGDYDLDSTAETSLQWIRLVNSFFVV
LFLCGLVVILLLRSIWRDIAKFNRIKISVYDRRLFGWRLIHGNLFRLPEHGMLLSILLGQGTQVFIMTFLSLFLAGLGFL
TPADQNVLVNYGVVLWLALEIPAGYMSAKMYKTFKGINWKMHFLLTTVLFPGIVFADIFIMNLILWMDGSPAAISFCTLA
SLFALYFGVSTPLTFLGVYFGKREKFEFPVYAPKHEHGSPQRTFFPKSTITIILGSLLPFGCIFLQLSYILNRIWSPHMY
YLFAFLLLLFLIFMISCSEVTVLLCYFRLCAEDRGWWWRAFLTSSFTSAYIFIYVIHYFFTKLQVTSIGSTFMYFGYAFI
LVLAFFLFTGTIGFFSCFFFVTTIYGVIKED