TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O07009|CYCB_BACSU Cyclodextrin-binding protein OS=Bacillus subtilis GN=cycB PE=1 SV=1
MKMAKKCSVFMLCAAVSLSLAACGPKESSSAKSSSKGSELVVWEDKEKSNGIKDAVAAFEKEHDVKVKVVEKPYAKQIED
LRMDGPAGTGPDVLTMPGDQIGTAVTEGLLKELHVKKDVQSLYTDASIQSQMVDQKLYGLPKAVETTVLFYNKDLITEKE
LPKTLEEWYDYSKKTADGSKFGFLALFDQIYYAESVMSGYGGYIFGKAKDGSYNPSDIGINNEGAVKGAALIQKFYKDGL
FPAGIIGEQGINVLESLFTEGKAAAIISGPWNVEAFSNAGINYGITKLPKLENGKNMSSFIGVKSYNVSAFSKNEELAQE
LAVFLANEKNSKTRYEETKEVPAVKSLANDPAIMKSEAARAVTEQSRFSEPTPNIPEMNEIWTPADSALQTVATGKADPK
QALDQAAETAKGQIKAKHSGK