TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O07535|O07535_BACSU Putative uncharacterized protein yhaT (YhaT protein) OS=Bacillus subtilis GN=yhaT PE=4 SV=1
MNIKENDLPGIGKKFEIETRSHEKMTIIIHDDGRREIYRFNDRDPDELLSNISLDDSEARQIAAILGGMVYKPQALESIE
MAFSDLIIEWFKVEKGAKSIGRTLGELDVRQNYDVTVIAIIKHNQEKLLNPGADSIIEENDTLVLSGERKHLKKLIHDFL
SGEGV