TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O07536|O07536_BACSU Putative uncharacterized protein yhaU (YhaU protein) OS=Bacillus subtilis GN=yhaU PE=4 SV=1
MDHLVFEVGTALVLVAIASVIANKIKFSIIPFLIVLGMLVGPHAPKMGIIDLTFIQSSEIIEFFGRMGVLFLLFYLGLEF
SVGKLIKSGKSIAVGGTIYILINFSLGLLYGFITGFSFLEVLILAGVITISSSAIVAKVLVDLKRTANPETELILGIIMF
EDIFLAVYLSVVSGLILGDATSVGSALLSILIAFGYMLLFFIAARKLPPLLNKLLDIRSNEVFIIVIFAALFFIAGFSET
IHVAEAIGALLLGLVFSETEHSDRIEHLVVPFRDFFGAMFFFSFGLSIDPFSLGEAVWLALGAVILTILGNFIAGMVAGR
RAGLSHKASSNIGLTIVSRGEFSIIVANLGIAGGLSATLKPFAALYVLILAILGPLVTKESKRIYRLLNKVFKWKPEVQP
AKKQG