TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O13020 AMINO ACID TRANSPORTER CHAIN ASUR4 - Xenopus laevis (African clawed frog).
MAADSVKRRQSGASKTEEEDRQAAEKMLHQNGNAEPKSGDGGAVELQRTITLVNGVAIIVGTIIGSGIFVTPTGVLREAG
SPGLSLLVWAVCGLFSIVGALCYAELGTTISKSGGDYAYVLEVYGALPAFLKLWVELLIIRPSSQYIVALVFATYLLKPV
FPTCPVPDDAAKIVACLCILLLTAINCYSVKAATRVQDAFAAAKLLALFLIIILGFVQLGKGGVEDLKPERSFEGTSTNV
GQWVLALYSGLFAYGGWNYLNFVVEEMIEPYKNLPRAIIISMPIVTLVYVLTNLAYFTTLTPEQMLNSEAVAVDFGNYHL
GVMAWIIPVFVGLSCFGSVNGSLFTSSRLFFVGAREGHLPSLLAMIHPRLLTPMPSLIFTCAMTLLYAFSNDIFSVINFF
SFFNWLCVALAIIGMMWLRYKKPELERPIKVNILLPIFFILACIFLIVVSFYMTPVECGIGFIIILTGVPVYFFGVWWQN
KPDWILHGIHSSTALLQKVMEAVPQES