TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O25623|O25623_HELPY Nickel-cobalt-cadmium resistance protein (NccB) OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=HP_0970 PE=4 SV=1
MKRALLWLMLMGVFSMGVSLKAKEYSEIILEEKNLQPMGLKVVKLDKEIFSKGLPFNAYIDFDSKSSVVQSLSFDASVVA
VYKREGEQVKAGDAICEVSSIDLSNLYFELQNNQNKLKIAKDITKKDLELYKAGVIPKREYQTSFLASQEMGLKVEQLES
AFKSFGVDPKNPKGQYGFRIVASDSGLLALAPKNVGEKILAFTSYVRISKSDDLIAQIKLPVGVSKSIKRDSPVYNEEGE
KIGKIQSVSVVLDKGSNTILATALLDEGNYHVGEMVEMYIQGSQPKDSVLIPSNALIRNGKDYLVFVRTPKGFRPVVVQV
LEERSKIFIVNAQNLHPNDSVAVGSLIGLKGMINNLGEE