TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O25624|O25624_HELPY Putative uncharacterized protein OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=HP_0971 PE=4 SV=1
MSMFSAGMLSAKIFTLQEFFKEVEINSMELIGKKADFKSRLNEQRSVNAWDFPYIENETSMVKNFQGIIEAQPRTLLVVR
PKLPWVSSLLSKSLSIKTIQYDKSYQLNKNLAFIGAKRLYLTYVMTKEKYQVYVQREANFYSQLKIAKEKVKAGSMSEKD
YINFNNSYLESKLAKTNVETKLIDLEKMLDTMLAIVEPVKEGAHFDTYLDHLHDVKVIGLDFEYVRLEPEALKFKLDRSL
YVDILDLTAKDYQVNAKLANRDVFNAFEFGIGSESYNSSTNLSVEVRIPLPVTPKNIYQKRKFLDLQSGTLAQNEVMKRN
IRINANSYLNQLKTKEAYIETQKEAIANKKRLMEMGRIAYEAQKIGLFEYLIYQNSYMDALITLAEAKIEYIDISALLEE
TLGESLTRLGELH