TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O26854|O26854_METTH Na+/H+-exchanging protein:Na+/H+ antiporter OS=Methanobacterium thermoautotrophicum GN=MTH760 PE=4 SV=1
MEYVAFSVAVIILLGLLFNRVFTRARLPGILGMLILGILIGPHGLNLISKSIMDISPDLRVIALIIILLRAGFGINLESL
RKVGMTAVKMSFIPDVFEGLAVMVASHYILGLPIIEAGILGFVIAAVSPAVIVPQMLSFIERRMGTAKGIPTIILTGASV
DDVVSITLFSVFLGIYQGQQVNLLVEAIGVPLSILTGITGGLALGLALVYLFRRFEIRNTEKTLIILGAAILLKNMGDLI
STYLPIAALVGVMVVGLVILERMPETGLKLSEKFNKVWIFAEILLFVLVGAQVDVRLIFHVGLLGLAVITAGLMVRSIGV
LLSLKGTDLNLKEKVFCISAYIPKATVQAAIGAIPLAAGVAAGETILAMAVLAILFTAPLGSLAVKWTGERFLEVERGN