TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O27990 CONSERVED HYPOTHETICAL PROTEIN - Archaeoglobus fulgidus.
MVQMRALLTAGFILIVFASQAVWVTFSPVLTLVSEEINVSVELLGLLAVTYPIFFLILTIPSGLLLDRDFKRWFLFGSVA
TFFAAAGRLVSFNYYWLLVCQLSGALGQPFLLNAFVPYASQLYEERRTLVISVLSLSMYLGTVFALAAGLKLYTAGGLTL
LILPSAVVATAGIVLVLIAVRAVRFTKAESFAVKQFGAVLKRKDLWIIGAILGFGVATFDNLATWLQPALRSAGLEKVAG
DAVALAIVLGLIGVAVIPDRVARANLRTIYMRSITPLIAAFFVILAFSLNTTLLFAFLGISGLLMLPAYAIIMDWIGKFC
DREVHGSATGFVGLTSRAISVALTLGAMYFISSAELYFTYLTIPITVAFILTLLLPNDRKKPSISKVF