TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O28652|Y1621_ARCFU UPF0324 membrane protein AF_1621 OS=Archaeoglobus fulgidus GN=AF_1621 PE=3 SV=1
MRETVKLIEVARELPVSRKNLQMLLLLLLCGAAAYIINLADPALEPLFLALVFGIVAGNLQRDEEKKRVVERYVPFLLPI
GITLYGVNINIPYLGEFHPEIVAATLISTSLIFLTVFWLSSRLKLSRQMSILLACGSGICGVSAIAIISPLIKPRKEEFS
AAIMIITAVGLTGAILYPSIAHYASISPDEFAVLAGATLHQTGIVKISSQLFGVEEEALAIKGIRIAMIALVVLILSIIY
SESRFYVPWYIVSFLGVALFSSTYLPGEVVQALRPLATVMFATTLAAICYTVNVGRVQRVGVKPLFASYAGWAVGVAFVL
LLLGSGAL