TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O28661 CATIONIC AMINO ACID TRANSPORTER (CAT-1) - Archaeoglobus fulgidus.
MQVQVSLSRDLSFFDITMIGIAGMIGAGVFALTGIAAGIAGPAIILAFFLNGIIATLTGLAYAELGSAMPQAGGGYLWIK
EAMGDYAGFMAGWIDWAAHTIACALYAVTFGAFFAEMLVGFVGLPLPHVLTAKISSLAMVSFLAYVNYRGAKESGFLGSL
VTVLKVLILLVFAGFGIIKMLSYPDWQSSFTPFFPTGFAGVLAAMGLTFIAFEGFEIIVQSGEEVKDPEKNIPKAIVVSL
WVAVAIYILIAFSLLGAVRADVPSWMYLGQLAELSLVKVADSIMPLGGWMILAGGLISTISAMNATIYSSSRVIFALSRS
GYLHRSLSAINERTKTPHYAIFFSYIIIAAASLAPIEAVASAASLMFIILFLAVNVTLIILRLRRPDIQSAFRLPLVPVL
PAIAAALLAVVSYFLITQVEHGEGVFLITIAWMFLGSFFYFAYSEKELEKREEEEVMTVFTEKPVEKMEYTILVPVANPV
IAKKLVRFAELIARKKKGAVVILNTVRLPQQTPISAPAKDVKKAKELVEGLMNLSVPSGGVVKVSHSVSEAILSTAEEWK
ANMIVMGWRGRTFRRDVVLGSTIDPVLLKAKCDVVVIRFEPGEKIPEFRDVLISTIGGPHAKLGYEIARALVEDKSGRIK
LLYVGSSEKEREKAEKVFEEAMEILNGLNVEREFAISSSPSDVVAREAESFDLVIVGASERTFLKNFLTGLFPEKVVMKT
SKTVAMTRKWVGLLNR