TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O29096|O29096_ARCFU Putative uncharacterized protein OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1171 PE=4 SV=1
MIIESLKEGLRGGDREGRCAVIAASLLSISVYVSGMAFEVAIAAIAISLIATKGRSLKLLRAFLPFYLLFAITALFSGIS
ALKTLLAFLAIISSGSIVFSSQPSEVSGALLFFRFPEKFVSLLQIALSMLPVVVSDFENVKSLYGRSYYRLLKAFVSTAI
LRAVSFSESLYSKNFSYKAVKKMRRPEKADYLLLLASTAVFVYAISLEVSTWMPSST