TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O29097|O29097_ARCFU Ribose ABC transporter, ATP-binding protein (RbsA-2) OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1170 PE=4 SV=1
MRGVWRLIELRVDKYTYPNGRVGLSDFYATFEGCDFIIGPTGSGKSTVLKMVNGLIPNFLGGTLEGKVRVFGEKPNPRIA
FFVKQNPEEMITSTQVIDELVFPLIQQGFGWGEAKREAEEVCEELGIGGLLERKTYELSTGELQLVQIAAALASKARILV
FDEPFANLSRKNVLKVIKILRDYPHLVSEHRLEFSSFFEKTINLGLECEDFEIPEVEPGEAVYDGLIELREGELIALVGD
NGAGKTMMLKKIATEMRKLGLDFSIVLQNPSYHLVEDSVGKEVDLETAKEFGIESLLSRHPQSLSMGQMKRVAIAKAFKS
KILLLDEPTAGQDCNFRRRLLYLLRKHRKSAIIATHDPYVAEHCDRKVEL