TCDB is operated by the Saier Lab Bioinformatics Group
>O30489|O30489_CYTJO Gliding motility protein - Cytophaga johnsonae (Flavobacterium johnsoniae).
MSIEVNSISKSYGEQKALNEISFKIEKGEIVGFLGPNGAGKSTLMKILTTYLLADSGSALVNGHDVMTNAKAVQQSIGYL
PEHNPLYLDLYVREYLAFNADVYKVPKSRIEEVIQLTGLTPESHKKISQLSKGYRQRVGLANALLHNPDVLILDEPTTGL
DPNQLMEIRNVIKNIGKDKTIFLSTHIMQEVEAICDRVIIIDKGQIVADNKLDHLVAADKEQVIEVEFDYQIEEQLLAKL
ENIASYKNTHDMTWELTFITDKDMRPAIFDFANENGLKTLQLNQKNKNLEAVFREITK