TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O30646|PAGO_SALTY Protein pagO OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pagO PE=3 SV=1
MRKVSISILFMLVSLTWGTTWLAMRIAVETIPPVFATGMRFMFAAPFLIIIAWLRKKTLLFPPGQRLFQFVICIFYFCIP
FSLMIYGETYVNSGLAAIIFANMPVAVLIASVLFLNEKAKLMQIAGLTIAITALTGILLEETNTSTESHWQGITALISAV
LIHAIIYTQCKKRSCTVSVITFNALPCLLAGLILSATGWFFERPQVSTFSVHSILATLYLGAFAGVFGILCYFALQQKAN
AFQASLVFLIFPLIAVSLEDYIYGYAISTHSMLLIIPLVIGIFLTLVARNLPVTSRCRDNSSQK