TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O31539|YETJ_BACSU Uncharacterized protein YetJ OS=Bacillus subtilis GN=yetJ PE=3 SV=1
MQATVHESKQSIMQRILTVFVFTLLIATVGLFIGQFVPVALMLPLSILEVAMIILAFWMRRRKAVGYAFVYTFAFVSGIT
LFPIVSHYASIAGAYVVLEAFGSTFVIFAVLGTIGAKMKKDLSFLWSFLLVAVLALAVVGIFNIFSPLNSAAMMAYSVIG
TIVFSLYILYDLNQIKHRHITEDLIPVMALSLYLDFINLFINLLRFFGILSSDD