TCDB is operated by the Saier Lab Bioinformatics Group
>O32204|O32204_BACSU YvsH protein - Bacillus subtilis.
MEQTKKWGFWLLTAFVVGNMVGSGIFSLPSSLASIASPFGATSAWLLTGAGVLMIALVFGHLSIRKPELTAGPQSYARAL
FSDPKKGNAAGFTMVWGYWVASWISNVAIITSLAGYLTSFFPILVDKREMFSIGGQEVTLGQLLTFAVCTILLWGTHAIL
VASINGASKLNFVTTLSKVLGFVFFIVAGLFVFQTSLFGHFYFPVQGENGTSIGIGGQVHNAAISTLWAFVGIESAVILS
GRARSQRDVKRATITGLLIALSIYIIVTLITMGVLPHDKLVGSEKPFVDVLYAIVGNAGSVIMALLAILCLFGTMLGWIL
LGSEVPYQAAKAGDFPAFFAKTNKKGSPVIALIITNVMSQVFIFSVISRTISDAFTFLTTAATLAYLIPYLVSAIYSLKV
VIKGETYDQLKGSRVRDGLIAILACAYSVFVIVTGTADLTTFILGIGLFFVGLIVYPFVSNKFQKEKQA