TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O32212|O32212_BACSU YvgP protein - Bacillus subtilis.
MDIFLVVLVLLTIIAISNIVNRFIPFIPVPLIQVALGILAASFPQGLHFELNTELFFVLFIAPLLFNDGKRTPRAELWNL
RAPILLLALGLVFATVIVGGYTIHWMIPAIPLAAAFGLAAILSPTDVVAVSALSGRVKMPKGILRLLEGEGLMNDASGLV
AFKFAIAAAVTGAFSLAQAAVSFVFISLGGLLCGVVISFLIIRFRLFLRRLGMQDVTMHMLIQILTPFVIYLAAEEIGVS
GILAVVAGGITHAVEQDRLESTMIKLQIVSSSTWNIILFILNGLVFVILGTQIPDVISVIFNDTAISNMKVIGYILVITF
TLMLLRFLWVLFFWNGKWFFNKDQNIYKPGLRSTLLISISGVRGAVTLAGSFSIPYFLEDGTPFPERNLILFLAAGVILC
TLVIATVVLPILTEKEEEDEERNKKLLTARRKLIKTALQTIKEDMNETNKTASLAVIAEYNEKMKNLRFQQYTSSNRIKK
HERKVRAQGVKAEQEALMKMLERGDIPEETANVLQERFNELEILYANPFKVGLSKTRLKRLMYWIFFGEHKKPEMSILNE
AGLIRATRVKTAKAAIEYLEKHKTDEHKEVFLSVITFYKQLIFRLEHSHHELKSSAHFENQKLEVKLKAVQAIRNEIQTL
FEEREISRDISHELRQYINDVEAAMLEGGE