TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O34897 YKUT PROTEIN - Bacillus subtilis.
MDFIKQYDWAGLITNAGVLLIKLAIMILLYFIVRSLGMKIIKHLFAKFEEQNSLSIGRAHTLRSLTLNIFAYTLIFIFFV
MVLDLFHYDPSALLAGAGIVGLAVGFGAQGLVSDIVTGFFILLEKQLDVGDYITVSTFDGIVEQVGLRTTQIRSFDGTLH
YIPNRNITNVSNHSRGTMQALVDIKVPAERNIDEMIHILQQVCDETAAALPQIKEGPNVIGIQELGTSEIVIRVIAKTEN
MEQWRVERVLRKEIKNAFDRAFPKETE