TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O46342 AMILORIDE-SENSITIVE NA+ CHANNEL (RPK PROTEIN) - Drosophila melanogaster (Fruit fly).
MTISDSELDSSKGIDLTFRRRRKAGSVACEGFITTYHEYCRNTSIHGVQYLGEQERPFRERIFWLFVFLISIYGCSTLIQ
SAYTKWTETPVIVSFAEKSTPVWNIPFPAVTVCSETKRVLKQKGKETTYADLYSQFSEDMRASRVFRPENVSALEMEEFR
TLLHVCNTQIIEEDIPLIAGDDLDYFDVLQRMLPQFDRYFFYCRWLSRFGECETFFRKTLTEEGICYTFNGLRATEIYRD
DTYQYQHSGEPLEMENISSQHTAWTLETGYALDSDVETFPARVLSAGARSGIFLALQSFKQEVDYACRGPVQGFKVLLHA
PDDVPQVSKQFVRIPMGKEVLIAVKPNMITMSSGIAEYHPVRRQCFLSHERSLRFFKVYTESNCQLECLANFTLTKCGCV
KFSMPRNVDMPVCGEDKIHCYDRAERELLVREFKRVKALNAGRENSRSVESACNCMPACTSLVYNTEISQANFDLEEMLV
AEGDTEFLKEYPGSQMSRLSIYFKQSQFITSKRSELYGMTEFLANCGGIFGLFMGFSILSLVEMIYHFTLRLFTNLKRLV
KG