TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O48430 Putative holin protein - Bacteriophage H19B.
MEKITTGVSYTTSAVGTGYWLLQLLDKVSPSQWVAIGVLGSLLFGLLTYLTNLYFKIREDRRKAVRGE