TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O51166|O51166_BORBU Membrane fusion protein OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=BB_0141 PE=1 SV=2
MNLIFNINLYLKKYFLVLFLVLVACVGDNKLDDKNIDKEKESSYRFPVIAMKVKKGILSDYLSLNGDVDTKVKADIFPDA
VGKITSLRIKLGAYVQKGQIVATLDPSRPGSVYLKSPVRAPISGYILNITKKIGETVNPQSNIAVVGRIDTKQILTYVSE
KYISNIKVGNDAIIEVGAYSNEKFKAKVSEISPILDSKSRTIEVYLTPIGSNLDKLIIGMFSKIKLITKRFKDVIKISRE
AVVEREGKKFVFKVDLESKSVQMLPITVLFEIDNIVALSGEVEENDLIVVEGMSALSNGSLINLVDTKEGLSAESNI