TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O52158 LACTOFERRIN-BINDING PROTEIN B PRECURSOR (LBPB) - Neisseria meningitidis.
MCKPNYGGIVLLPLLLASCIGGNFGVQPVVESTPTAYPVTFKSKDVPTPPPAKPSIEITPVNRPAVGAAMRLPRRNTAFH
REDGTEIPNSKQAEEKLSFQEGDVLFLYGSKGNKLQQLKSEIHKRDSDVEIRTSEKENKKYDYKFVDAGYVYVKGKDEIK
WTSDYKQFSNRLGYDGFVYYSGERPSQSLPSAGTVEYSGNWQYMTDAKRHRAGKAVGIDNLGYYTFYGNDVGATSYAAKD
VDEREKHPAKYTVDFGNKTLTGELIKNQYVKPSEKQKPLTIYNITADLNGNRFTGSAKVNPDLAKSHANKEHLFFHADAD
QRLEGGFFGDKGEELAGRFISNDNSVFGVFAGKQNSPVPSGKHTKILDSLKISVDEASGENPRPFAISPMPDFGHPDKLL
VEGHEIPLVSQEKTIELADGRKMTVSACCDFLTYVKLGRIKTERPAAKPKAQDEEDSDIDNGEESEDEIGDEEEGTEDAA
AGDEGSEEDEATENEDGEEDEAEEPEEESSAEGNGSSNAILPVPEASKGRDIDLFLKGIRTAETNIPQTGEARYTGTWEA
RIGKPIQWDNHADKEAAKAVFTVDFGKKSISGTLTEKNGVEPAFRIENGVIEGNGFHATARTRDDGIDLSGQGSTKPQIF
KANDLRVEGGFYGPKAEELGGIIFNNDGKSLGITEGTENKVEADVDVDVDVDVDADADVEQLKPEVKPQFGVVFGAKKDN
KEVEK