TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O53781|O53781_MYCTU PROBABLE CONSERVED INTEGRAL MEMBRANE PROTEIN OS=Mycobacterium tuberculosis GN=Rv0585c PE=4 SV=2
MRVDGRDIGVSGNLLQPLTRRTNDIIRAVLAAIYLVAVITSSLITRPQWVALEKSISEIVGVLSPSQSDLVYLGYGLAIL
ALPFVILIGLIVSRQWKLLGAYAAAGLMAVLPLSISSSRIAAPRWHFDLSDRLATLLAQFLDDPRWIAMLAAVLTVSGPW
LPARWRHWWWALLLAFVPIHLVVSAIVPARSLLGLAVGWLVGALVVLVVGTPALEVPLDGAIRALAKRGFAVSGLAVVRP
AGPGPLVLSAACEQPNAGACSEALIELYGPHQSGGGALRQLWLKLTLRGTETAPLQASMRRAVEHRALMAIAFGDLGMAN
TTVIAVSPLDRGWTLYAHRPARGIGISECTKTTPTAHVWEALRTLHDQQISHGDLCSAEITVDNGAVLFGGFGEAEYGAT
DAQLQSDLAQLLVTTSALYDAEAAVTAAIDTFGKQAILAASRRLTKSAVPKRIRESITDPNAVIASTRAEVMRQTGADQI
KAETITRFSRGQLIQLVLIGALVYVAYPFISTVPTFFSQLRTANWWWALLGLAVSALTYVGAAAALWACADGLVGFWKLS
IMQVANTFAATTTPAGVGGLALSTRFLQKGGLTAVRATAAVALQQSVQVIVHLVLLILFSALAGTSTDLSHFVPNATVLY
LIAGVALGIVGTFLFVPKLRRWLATAVRPKLREVTNDLIALAREPKRLALIVLGCAGTTLGAALALWASIEAFGGGTTFV
TVTVVTMVGGTLASAAPTPGGVGAVEAALIGGLAAFGVPAALGVPSVLLYRLLTCWLPVFAGWQVMHWLTRHEMI