TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O54507 TONB DEPENDENT OUTER MEMBRANE SIDEROPHORE RECEPTOR PROTEIN - Salmonella cholerae-suis (Salmonella enterica).
MGMRVKKFIWLITVVSTGINSPLSAAESTDDNGETIVVESTAEQVLKQQPGVSIITRDDIQKNPPVNDLADIIRKMPGVN
LTSNSASGTRGNNRQIDIRGMGPENTLVLIDGVPVTSRNSVRYSWRGERDTRGDTNWVPPEMVERIEMIRGPAAARYGSG
AAGGVVNIITKRPTNDWHGSLSLYTNYPESSKEGDTRRGNFSLSGPLAGDTLSTMRLYGNLNRTDADSWDINSSAGTKNA
AGREGVTNKDINSVFSWKMTPQQILDFEAGYSRQGNIYAGDTQNSNSNAVTKSLAQSGRETNRLYRQNYGLTHNGIWGWG
QSRLGFYYEKTDNTRMNEGLSGGGEGRITNDQTFTTNRLTSYRTSGEVNVPVIWLFEQTLTVGAEWNRDELNDPSSTSLT
VKDSNIAGIPGSAANRSSKNKSEISALYVEDNIEPMAGTNIIPGLRFDYLSESGSNFSPSLNLSQELGEFVKVKAGIARA
FKAPNLYQTSEGYLLYSKGNGCPKDITSGGCYLVGNKNLDPEISINKEIGLEFTVDDYHASVTYFRNDYQNKIVAGDQII
GRSASGAYVLQWQNGGKALIEGIEASMAVPLMPDRLNWNTNATYMITSEQKDTGNPLSIIPKYTVNTFLDWTITNALSAN
VNWTLYGKQKPRTHAESRSEETKGLSGKALGAYSLVGANVNYDINKNLRLNVGISNIFDKQIYRSAEGANTYNEPGRAYY
AGVTASF