TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O57474|CXA1_DANRE Gap junction alpha-1 protein OS=Danio rerio GN=gja1 PE=1 SV=3
MGDWSALGRLLDKVQAYSTAGGKVWLSVLFIFRILVLGTAVESAWGDEQSAFKCNTQQPGCENVCYDKSFPISHVRFWVL
QIIFVSTPTLLYLAHVFYLMRKEEKLNRKEEELKAVQNDGGDVELHLKKIELKKFKHGLEEHGKVKMKGSLLRTYIFSII
FKSICEVVFLVIQWYLYGFSLSAVYTCERTPCPHRVDCFLSRPTEKTIFIIFMLVVSLFSLLLNIIELFYVLFKRIKDRV
KSRQNTQFPTGTLSPTPKELSTTKYAYYNGCSSPTAPLSPMSPPGYKLATGERTNSCRNYNKQANEQNWANYSTEQNRLG
QNGSTISNSHAQAFDYPDDTHEHKKLTPGHELQPLALIDARPCSRASSRMSSRARPDDLDV