TCDB is operated by the Saier Lab Bioinformatics Group
>O65623|O65623_ARATH Plant uncoupling mitochondrial protein - Arabidopsis thaliana (Mouse-ear cress).
MVAAGKSDLSLPKTFACSAFAACVGEVCTIPLDTAKVRLQLQKSALAGDVTLPKYRGLLGTVGTIAREEGLRSLWKGVVP
GLHRQCLFGGLRIGMYEPVKNLYVGKDFVGDVPLSKKILAGLTTGALGIMVANPTDLVKVRLQAEGKLAAGAPRRYSGAL
NAYSTIVRQEGVRALWTVLGPNVARNAIINAAELASYDQVKETILKIPGFTDNVVTHILSGLGAGFFAVCIGSPVDVVKS
RMMGDSGAYKGTIDCFVKTLKSDGPMAFYKGFIPNFGRLGSWNVIMFLTLEQAKKYVRELDASKRN