TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O68456|O68456_THEET D-xylose-binding protein OS=Thermoanaerobacter ethanolicus OX=1757 GN=xylF PE=4 SV=1
MFKKVSKKFALLIVAMFTLGIILSGCATTQNNQSNSSSTTPSSNESTKAPEKIKIGFSMDNLALERWQKDRDLFVKKAQE
LGAEVLVQSANSDPQLQYSQCQNLLAQGIQVLVILPTDGSAIAPIVEEAHKAGVKVLAYDRLIMNSDLDYYVSFDNVKVG
ELQAEAITKLVPKGRYFLLEGSPTDNNAKLFYEGQMKVLKPLVDKGDIKIVGEQWAKNWDTNEAYKIMQNALVANNNKID
AVVAANDSTALGAIRALDEQGLAGKIPISGQDADLANCQLIVEGKQTMTVYKPIVLEATKAAEMAVSIAKGEKVETNGTV
NNGKIDVPSMLLTPIAVDKNNMVDTVIKDGFQKLEDVYKNVSKDLS