TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O68877|HMUV_PSEAE Hemin import ATP-binding protein HmuV OS=Pseudomonas aeruginosa GN=hmuV PE=3 SV=1
MLRVENLSIRRGGKTVLEGLELELRPGEMLGVLGPNGAGKSTLLGALCGELEPAEGLVLLDERGLDDWPGVARAQRLAVL
PQSSSLGFAFPVEAVVGFGRLPHSSGRERDVQIVAEALAAADASHLAGRSYLALSGGERQRVHLARVLAQLWPGEPGQVL
LLDEPTSALDPLHQHTTLQAVHDFARRGASVLVILHDLNLAARYCDRLLLLQNGRPHLLGTPEEVLRPEPLRAVFGLEVL
VQRHPERGHPLIVAR