TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O75712|CXB3_HUMAN Gap junction beta-3 protein OS=Homo sapiens GN=GJB3 PE=1 SV=1
MDWKTLQALLSGVNKYSTAFGRIWLSVVFVFRVLVYVVAAERVWGDEQKDFDCNTKQPGCTNVCYDNYFPISNIRLWALQ
LIFVTCPSLLVILHVAYREERERRHRQKHGDQCAKLYDNAGKKHGGLWWTYLFSLIFKLIIEFLFLYLLHTLWHGFNMPR
LVQCANVAPCPNIVDCYIARPTEKKIFTYFMVGASAVCIVLTICELCYLICHRVLRGLHKDKPRGGCSPSSSASRASTCR
CHHKLVEAGEVDPDPGNNKLQASAPNLTPI