TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O83324|O83324_TREPA Conserved hypothetical integral membrane protein OS=Treponema pallidum (strain Nichols) GN=TP_0302 PE=3 SV=1
MGVIGTTVIAILHRAAPLACAAAGALATEYAGVLGIFMEGVITFSSFCIAFFALVWGSYWGGLGITVCVVPLCLFFVAVG
TERMRANPFLTGIAVHFSAMGMSAFGASSMFARAAASAMQMDTAAHGVSFTHVSLAHTRVLPHPLWGTAVAFALVWVFHL
YLYSTNVGINFMHSGEGALALQVRGTDAARYRMVSWAVAGVCAVCAGGLLVLRVGTYTPQMAAGRGWTALAIVFLARKRM
MWCVPAAIFFSGIEHMCDVLQGTHVVPTGVLFALPYILSLVVFVCTRRTSPCRRGERRRSRLLFAYLQRVTCA