TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O84071|Y068_CHLTR Probable metal transport system ATP-binding protein CT_068 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=CT_068 PE=3 SV=1
MNRDNAIAWSVEDLCVNYDHSDVLCHITFSLPAGAMAAIIGPNGAGKSTLLKASLGLIRASSGQSLFFGQRFSKVHHRIA
YMPQRASVDWDFPMTVLDLVLMGCYGYKGIWNRISTDDRQEAMRILERVGLEAFANRQIGKLSGGQQQRAFLARSLMQKA
DLYLMDELFSAIDMASYQMVVDVLQELKSEGKTIVVIHHDLSNVRKLFDHVILLNKHLVCSGSVEECLTKEAIFQAYGCE
LELLDYTLKLSRGKYQGSC