TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O84733|O84733_CHLTR Putative uncharacterized protein OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=CT_728 PE=4 SV=1
MASEYEHFGNLSPEDHVKEVQDLHKVCKGEPHQTKKGYWYHLTCDAIDCGVFLFFIRTIFFLVPAIPVTSYGKILFATGI
SWIFYTSCKRAQAAWAYIELTHRNMLQEKKEIETNPEQERIELAVLYANQGFQEPLISQMLDFVCSDSSLLLSTMLREEL
HIQLEDYPHPLKQGNVKALGGILGLLLFAPITLAVSYTIAAILASFMIGVLFAVKTRLIKNAIAPAIVWGVGMFITAISL
CCSLIRLF