TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O87343 LACTOFERRIN BINDING PROTEIN A PRECURSOR - Neisseria meningitidis.
MNKKHGFQLTLTALAVAAAFPSYAANPETAAPDAAQTQSLKEVTVRAAKVGRRSKEATGLGKIVKTSETLNKEQVLGIRD
LTRYDPGVAVVEQGNGASGGYSIRGVDKNRVAVSVDGVAQIQAFTVQGSLSGYGGRGGSGAINEIEYENISTVEIDKGAG
SSDHGSGALGGAVAFRTKEAADLISDGKSWGIQAKTAYGSKNRQFMKSLGAGFSKDGWEGLLIRTERQGRETHPHGDIAD
GVAYGINRLDAFRQTYGIKKPSEGGEYFLAEGESELKPVAKVAGNGNYLNNQLNRWVKERIEQNQPLSAEEEAMVREAQA
RHENLSAQAYTGGGRILPDPMDYRSGSWLAKLGYRFGGRHYVGGVFEDTKQRYDIRDMTEKQYYGTDEAKKFRDKSGVYD
GDDFRDGLYFVPNIEEWKGDQKLIRGIGLKYSRTKFIDEHHRRRRMGLLYRYENEKYSDNWADKAVLSFDKQGVATDNNT
LKLNCAVYPAVDKSCRASADKPYSYDSSDRFHYREQHNVLNASFEKSLKNKWTKHHLTLGFGYDASNAISRPEQLSHNAA
RISEYSDYTDKGDKYLLGKPEVVEGSVCGYIETLRSRKCVPRKINGSNIHISLNDRFSIGKYFDFSSGGRYDRKNFTTSE
ELVRSGRYVDRSWNSGIVFKPNRHFSLSYRASSGFRTPSFQELFGIDIYHDYPKGWQRPALKSEKAANREIGLQWKGDFG
FLEISSFRNRYTDMIAVADHKTKLPNQAGQLTEIDIRDYYNAQNMSLQGVNILGKIDWNGVYGKLPEGLYTTLAYNRIKP
KSVSNRPGLSLRSYALDAVQPSRYVLGFGYDQPEGKWGANIMLTYSKGKNPDELAYLAGDQKRYSTKRASSSWSTADVSA
YLNLKKRLTLRAAIYNIGNYRYVTWESLRQTAESTANRHGGDSNYGRYAAPGRNFSLALEMKF