TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O97148|MTH_DROME G-protein coupled receptor Mth OS=Drosophila melanogaster GN=mth PE=1 SV=1
MKTLLVLRISTVILVVLVIQKSYADILECDYFDTVDISAAQKLQNGSYLFEGLLVPAILTGEYDFRILPDDSKQKVARHI
RGCVCKLKPCVRFCCPHDHIMDNGVCYDNMSDEELAELDPFLNVTLDDGSVSRRHFKNELIVQWDLPMPCDGMFYLDNRE
EQDKYTLFENGTFFRHFDRVTLRKREYCLQHLTFADGNATSIRIAPHNCLIVPSITGQTVVMISSLICMVLTIAVYLFVK
KLQNLHGKCFICYMVCLFMGYLFLLLDLWQISISFCKPAGFLGYFFVMAAFFWLSVISLHLWNTFRGSSHKANRFLFEHR
FLAYNTYAWGMAVVLTGITVLADNIVENQDWNPRVGHEGHCWIYTQAWSAMLYFYGPMVFLIAFNITMFILTAKRILGVK
KDIQNFAHRQERKQKLNSDKQTYTFFLRLFIIMGLSWSLEIGSYFSQSNQTWANVFLVADYLNWSQGIIIFILFVLKRST
WRLLQESIRGEGEEVNNSEEEISLENTTTRNVLL