TCDB is operated by the Saier Lab Bioinformatics Group
>OEU21812.1 hypothetical protein FRACYDRAFT_231958 [Fragilariopsis cylindrus CCMP1102]
MSDGLDPSGDMIQAPDTVEQEQEQQQEQEQDEQGNFVTRLRNQRRIRRFTEDNPLQSQPPRGFRIHRQPNLADNGAENDP
FVIDAGPVPAGNENITSQSQPPRPPLPSMNGSSIRQVFDTGPRPGLGPTGDQNNPSLSQPQPRPPIIINRNNVRPIHFNV
GSGRLMSMRQQPSNNPSQSQTQTRVDPRPSMSSNNIRQVHVQVQVDPLVPQPVPPSSRNTTTTTTTTTTEEEVDPPDYER
FKCEICYEYLNEPVGCGKCSSRFCRSCLQRVYESDKERNQKPRCPVCRCEYDKMAPDAGMYGVTNGGSAPTLPCRYVSVG
CPFRKLPLPEIANHEAVCDHVLMRCRYSQYGCKWTGKRGLIKAHEEFGCKIAPTGNFIEQFRHQKAEHAMKMEMITQQIA
HNSRFVHVLRSTYARDNQRKSLTDIFRLVQYFYTLLCLTPHFFMTKDLYVSYWRTNNTRAAVINFCVCLPFIAACFGVTR
RATSSFFDFFDVISPDKTLAILAKALEGRDLTSIPNATTTATAMMDDIFQNSQAEELTVEIILGLCVGVVGLLVVTLTFV
DVKSSILWDKISIPRLGKFPLVGDAEAISIFTLLLS