TCDB is operated by the Saier Lab Bioinformatics Group
>OGF17285.1 hypothetical protein A2W00_14110 [Candidatus Eisenbacteria bacterium RBG_16_71_46]
MTTLAGRLRTAAWLGWQIESNWADPLVFAIYSVARPLATALILMGIYWAVTGGHLQRDAFLLFYIGNAFHEYVLRLVVGM
GWVVVEEREEYETLKYVYASPIGIFTYLWGRSSVKFAQATLSVVLMFLMGWFVLGLRWDLGVVRWGAFLLAFGIGLVAVV
YLGFLVAGLALLLPRAAMTMNEGLAVALYLLCGVIYPIDLLPRGLQELTLLLPFTYWYEALRRFLIGHGASERLSALSDG
QLLGALIAATLVFAVASHFGYLALERRARKLGRLDQTTLF