TCDB is operated by the Saier Lab Bioinformatics Group
>OGG98050.1 hypothetical protein A2508_02310 [Candidatus Lambdaproteobacteria bacterium RIFOXYD12_FULL_49_8]
MVQFDQVIQLTLSTHEERSVFYQNFLVKGLPGERSVKVAIKYQVCSFRVCLPPAQSLLVADYQVEPGPPRAQFLNADRSV
DTLPESGRRINKGLGKEGFWAFIGLAAFMGLASLITPCVFPMVPITISYFSKQADGNPAKLFGLATLFGGGIVATYTGTG
LILSWIFGAGAASQLATNPWVNLTIALVFILFSFSLMGAFNIRLPAQIEGYFDAKARATGGALGVVLMGFTFTLTAFTCT
VQFVGTLMIAAAQGQMFWPLLGMIVFSSVFAFPFFLLALAPGLVGKMHRGTGQWLGRAKWVLGMLELMASIKFLSNADLV
WQTGLISRDLNLQVWMALLGLIIGYLIFTGFRQGRFKSPVQLAWVGFFVLLLVLTSQGLGGRSLGSLIDSVLPPAEGRHL
EAAEYASEEEIKSLVWMDNLEAAQALALSQKKPIFLEFTGYTCVNCRWMEQNVLAQKAIYIRLKERYILVRLFTDGGPDK
DRNLALQINRFQTVALPLYLILTPQGQEQGRYIGLALAGAEFAAFLDKAP