TCDB is operated by the Saier Lab Bioinformatics Group
>OGI95701.1 hypothetical protein A2917_00040 [Candidatus Nomurabacteria bacterium RIFCSPLOWO2_01_FULL_42_17]
MEITNLTIPILVGAAIIDSINPCAFGVLIFLLAYLFKAFHSRRSVLLHGLTYIGGVFITYLIAGLVLLPIISQLGRVSTG
AYIGIGVILIIFGLLEIKDFFFYGKGFSLGILPSVGKRIEMLVRKITGKLSTSFFLGVFVALVELPCTGAVYLGILALVS
LAGLTANNFILLVIYNLLFVLPLVVILLFIHRVGQTEKFEMWREKYRGYMRLAIGLLLVSLGVWMINFIL